Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243

Beta-amyloid peptide (Aβ) is essential for studying neurotoxicity, oxidative stress, and plaque formation, widely used to model Alzheimer's pathology in cellular and animal systems.
Specifications
|
Sequence one letter code |
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
|
Sequence three letter code |
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
|
CAS Number |
131438-79-4 |
|
Molecular Formula |
C194H295N53O58S1 |
|
Molecular Weight |
4329.82 |
|
Modification |
N/A |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Lambert MP et al. (1998): Identified Aβ (1-42) oligomers as key neurotoxic agents (PNAS).
2. Walsh DM et al. (2000): Highlighted Aβ (1-42) as the predominant species in AD brains (J. Biol. Chem.).
Hot Tags: beta-amyloid (1-42), mouse, rat, beta-amyloid (1-42), mouse, rat suppliers, custom peptides, peptide synthesis
Previous
You Might Also Like
Send Inquiry











