Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
Beta-Amyloid (42-1), Human
Catalog Number: BRS16012
CAS Number：317366-82-8
Molecular Formula：C203H311N55O60S1
Molecular Weight：4514.1
Purity：Peak Area by HPLC ≥95%
Form：Lyophilized
Beta-Amyloid (42-1) Human, the reverse sequence of Aβ(1-42) Human, is used as a control in Alzheimer's disease (AD) research.
Specifications
|
Sequence one letter code |
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
|
Sequence three letter code |
Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
|
CAS Number |
317366-82-8 |
|
Molecular Formula |
C203H311N55O60S1 |
|
Molecular Weight |
4514.1 |
|
Modification |
N/A |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Takeda, S., et al. (2010). Alzheimer's disease neuroimaging and the "amyloid cascade hypothesis." Neurobiology of Aging, 31(9), 1510–1517.
2. Stine, W. B., Jr., et al. (2003). In vitro characterization of conditions for amyloid-beta peptide oligomerization and fibrillogenesis. The Journal of Biological Chemistry, 278(13).
Hot Tags: beta-amyloid (42-1), human, beta-amyloid (42-1), human suppliers, peptides products, Flag Peptide CAS 98849 88 8, peptides in medicine, cyclic rgd, peptides for enzyme inhibition studies, peptides for hair care
You Might Also Like
