Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243

Human galanin, originally been isolated from colon and pituitary, that activates the rat galanin receptor and inhibits acetylcholine release, glutamate release and carbachol-stimulated phosphatidylinositol hydrolysis in the hippocampus. Recent studies indicated that galanin is also linked to behavioral and cognitive deficits in Alzheimer's disease.
Specifications
|
Sequence one letter code |
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
|
Sequence three letter code |
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser |
|
CAS Number |
119418-04-1 |
|
Molecular Formula |
C139H210N42O43 |
|
Molecular Weight |
3157.45 |
|
Modification |
N/A |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
Hot Tags: galanin (human), galanin (human) suppliers, peptides for enzyme inhibition studies, peptides for tissue engineering, peptides derivatization, peptides for vaccine development, Beta Amyloid 1 40 Human CAS 144409 98 3, peptides characterization
You Might Also Like






![E[c(RGDyK)]2](https://img01.v15cdn.com/nopic.webp?size=147x0)


