Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
SARS-CoV-2 Spike RBD RBM (aa 437–508) Overlapping Peptide Library
Specifications: 16 peptides/set,1 mg/vial (Individually Packaged)
Purity: ≥ 85% (HPLC & MS Reports Included)
Form: Lyophilized Powder (In Stock)
Lead Time: Ships within 24–48 hours
SARS-CoV-2 Spike RBD RBM (aa 437–508) Overlapping Peptide Library
This product is in stock and ready for immediate shipment. This library covers the Receptor-Binding Motif (RBM) of the SARS-CoV-2 Spike RBD, corresponding to amino acids 437–508 of the Spike protein.
Product Specifications
|
Parameter |
Specification |
|
Target |
SARS-CoV-2 Spike Protein, RBD / RBM Region |
|
Target Region |
RBM, aa 437–508 |
|
Reference Sequence |
NLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY |
|
Peptide Design |
Overlapping Peptide Library |
|
Peptide Length |
Predominantly 15-mer |
|
Overlap |
11 aa |
|
Offset |
4 aa |
|
Total Peptides |
16 |
|
Purity |
>85% by HPLC |
|
Amount |
1 mg per peptide |
|
Packaging |
Lyophilised powder, individually labelled vials |
|
Quality Control |
Individual HPLC chromatogram + LC-MS mass spectrum for each peptide |
|
Storage |
−20°C (protected from light/moisture); −80°C recommended for long-term |
Peptide List (16 Overlapping Peptides)
|
No. |
Peptide Sequence(N-C) |
|
1 |
NLDSKVGGNYNYLYR |
|
2 |
KVGGNYNYLYRLFRK |
|
3 |
NYNYLYRLFRKSNLK |
|
4 |
LYRLFRKSNLKPFER |
|
5 |
FRKSNLKPFERDIST |
|
6 |
NLKPFERDISTEIYQ |
|
7 |
FERDISTEIYQAGST |
|
8 |
ISTEIYQAGSTPCNG |
|
9 |
IYQAGSTPCNGVEGF |
|
10 |
GSTPCNGVEGFNCYF |
|
11 |
CNGVEGFNCYFPLQS |
|
12 |
EGFNCYFPLQSYGFQ |
|
13 |
CYFPLQSYGFQPTNG |
|
14 |
LQSYGFQPTNGVGYQ |
|
15 |
GFQPTNGVGYQPY |
|
16 |
SYGFQPTNGVGYQPY |
Product Highlights
In Stock & Ready to Ship – Regular inventory enables fast dispatch after QC, reducing custom-synthesis wait times.
Targeted RBM Coverage – Focuses on aa 437–508, the key region for Spike–ACE2 interaction and antibody recognition.
High-Resolution Overlapping Design – 15-mer peptides with 11-aa overlap (4-aa offset) provide dense, continuous coverage for linear epitope mapping.
Individually Packaged – Each peptide is supplied in separate vials (1 mg/vial, lyophilised) with clear labels for easy handling.
Independent QC for Every Peptide – Each peptide comes with its own HPLC purity data and LC-MS mass spectrum for quality confirmation.
Research-Ready Format – No need for custom synthesis; directly applicable to ELISA, peptide microarrays, binding assays, and epitope screening.
Research Applications
B-Cell Epitope Mapping – Identify and localise linear antibody epitopes within the RBM region.
Antibody Binding Characterisation – Use in ELISA or peptide-based binding assays to assess antibody reactivity with individual RBM peptides.
Competitive & Binding Studies – Investigate interactions with antibodies, receptor proteins, or candidate inhibitors.
Peptide Microarray & Immunoassays – Suitable for high-throughput epitope screening and immunoassay development.
Immunological Research – Support studies on SARS-CoV-2 Spike-specific immune responses and epitope discovery.
Ordering & Inquiries
For pricing or ordering, please at: sales@biorunstar.com
All in-stock items are dispatched within 24–48 hours after order confirmation.
Need a tailored library? Generate your own overlapping peptide library with our online Overlapping Peptide Libraries Generator.
Hot Tags: sars-cov-2 spike rbd rbm (aa 437–508) overlapping peptide library, sars-cov-2 spike rbd rbm (aa 437–508) overlapping peptide library suppliers
You Might Also Like
