Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
Specifications
|
Sequence one letter code |
ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 |
|
Sequence three letter code |
Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2 |
|
CAS Number |
132699-74-2 |
|
Molecular Formula |
C206H826N56O64S1 |
|
Molecular Weight |
4643.26 |
|
Modification |
C-terminal Amidation |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
Galanin Message-Associated Peptide (GMAP), derived from the preprogalanin precursor, has emerged as a novel player in immune defense. Recent studies reveal its antimicrobial properties, notably inhibiting Candida albicans growth and hyphal transition, as well as activity against drug-resistant strains like C. krusei. GMAP is also expressed in immune-relevant tissues and upregulated after neuronal injury, suggesting a neuroimmune role. These findings position GMAP as both an antimicrobial peptide and a modulator of immune responses, with potential applications in developing new therapies for infections and inflammation-related conditions. Its dual role highlights the intricate connection between the nervous and immune systems.
Hot Tags: galanin message associated peptide (1-41) amide, galanin message associated peptide (1-41) amide suppliers, Beta Amyloid 1 40 Human CAS 144409 98 3, c rgdfk, peptides for diagnostic assays, peptides for gene therapy, peptides function, Cyclo RGDfK CAS 161552 03 0
You Might Also Like
