Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
LL-37 is a 37-residue, amphipathic, helical antimicrobial peptide derived from the cathelicidin family, found exclusively in humans. It exhibits broad-spectrum antimicrobial activity and is expressed in various human tissues, including epithelial cells of the skin, gastrointestinal tract, testis, and respiratory tract.
Specifications
|
Sequence one letter code |
[LL-37, 37 aa] |
|
Sequence three letter code |
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
|
CAS Number |
597562-32-8 |
|
Molecular Formula |
C205H340N60O53 |
|
Molecular Weight |
4493.6 |
|
Modification |
N/a |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Dürr, U. H. N., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta (BBA) - Biomembranes, 1758(9), 1408-1425.
Hot Tags: Antimicrobial Peptide, LL-37, HA Peptide CAS 92000 76 5, peptides for muscle building, peptides solubility, peptides for gene editing, peptides for neurodegenerative disease research, Cyclo RGDfV
You Might Also Like
