Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
PACAP-38 (Pituitary Adenylate Cyclase-Activating Polypeptide-38) is a neuropeptide composed of 38 amino acids, highly conserved across multiple species, including humans, mice, sheep, pigs, and rats. It plays diverse physiological roles in various systems. PACAP-38 promotes neuronal survival through the cAMP-PKA pathway, reducing oxidative stress and inflammation. It also regulates the function of T cells and macrophages, suppressing the release of inflammatory cytokines, thereby contributing to immune modulation. In the cardiovascular system, PACAP-38 enhances myocardial function and inhibits cardiomyocyte apoptosis by activating the adenylyl cyclase pathway. Additionally, in the gastrointestinal system, it modulates smooth muscle contraction and secretion through the enteric nervous system.
Specifications
|
Sequence one letter code |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
|
Sequence three letter code |
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
|
CAS Number |
124123-15-5 |
|
Molecular Formula |
C203H331N63O53S1 |
|
Molecular Weight |
4534.32 |
|
Modification |
C-terminal Amidation |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Vaudry et al., "Pituitary adenylate cyclase-activating polypeptide and its receptors: 20 years after the discovery," Pharmacological Reviews, 2009.
2. Abad et al., "PACAP modulates the innate immune response to bacterial endotoxins," Journal of Neuroimmunology, 2006.
3. Szakaly et al., "PACAP in cardioprotection," Journal of Molecular Neuroscience, 2012.
4. Sundler et al., "PACAP and sensory neurons in the gut," Annals of the New York Academy of Sciences, 1996.
5. Cline et al., "PACAP signaling and its role in cancer," Endocrine-Related Cancer, 2009.
Hot Tags: pacap-38 (human, mouse, ovine, porcine, rat), pacap-38 (human, mouse, ovine, porcine, rat) suppliers, peptides pricing, peptides for slimming, peptides for metabolomics, peptides function, peptides for enzyme inhibition studies, peptides quality control
You Might Also Like
