Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243

PACAP-27 (Pituitary Adenylate Cyclase-Activating Polypeptide-27) is a neuropeptide composed of 27 amino acids, highly conserved across species such as humans, mice, sheep, pigs, and rats. It is derived from the same precursor as PACAP-38 and exhibits similar biological functions by interacting with PAC1, VPAC1, and VPAC2 receptors.
Specifications
|
Sequence one letter code |
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
|
Sequence three letter code |
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 |
|
CAS Number |
127317-03-7 |
|
Molecular Formula |
C142H224N40O39S1 |
|
Molecular Weight |
3147.65 |
|
Modification |
C-terminal Amidation |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Vaudry et al., "PACAP and its receptors: Neuroprotective and regenerative mechanisms," Pharmacological Reviews, 2009.
2. Abad et al., "The role of PACAP in immune regulation and inflammation," Journal of Neuroimmunology, 2006.
3. Szakaly et al., "Protective effects of PACAP-27 on the heart," Journal of Molecular Neuroscience, 2013.
4. Sundler et al., "PACAP in the gastrointestinal tract: Roles and mechanisms," Annals of the New York Academy of Sciences, 1996.
5. Cline et al., "PACAP as a modulator of tumor growth," Endocrine-Related Cancer, 2010.
Hot Tags: pacap-27 (human, mouse, ovine, porcine, rat), pacap-27 (human, mouse, ovine, porcine, rat) suppliers, peptides quality control, 3xFlag Peptide CAS 402750 12 3, peptides modification, peptides for slimming, peptides for sale, cyclic rgd
You Might Also Like







