Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
RVG-Cys (RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling.
Specifications
|
Sequence one letter code |
YTIWMPENPRPGTPCDIFTNSRGKRASNGC |
|
Sequence three letter code |
Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys |
|
CAS Number |
1186105-01-0 |
|
Molecular Formula |
C144H222N44O44S3 |
|
Molecular Weight |
3369.77 |
|
Modification |
N/A |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
Hot Tags: rvg29-cys, rvg29-cys suppliers, cyclic rgd peptide, peptides for immunology research, peptides for crispr cas9, peptides distribution, rgdfk peptide, custom peptides
You Might Also Like
Send Inquiry
