Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243

Exendin-4 is a peptide derived from the venom of the Gila monster (Heloderma horridum), similar to the human glucagon-like peptide-1 (GLP-1). It is known for its ability to stimulate insulin secretion, making it a promising candidate for the treatment of type 2 diabetes.
Specifications
|
Sequence one letter code |
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
|
Sequence three letter code |
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
|
CAS Number |
141758-74-9 |
|
Molecular Formula |
C184H282N50O60S1 |
|
Molecular Weight |
4186.63 |
|
Modification |
C-terminal Amidation |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Drucker, D. J. (2003). "Glucagon-like peptide 1 and its therapeutic potential." Proceedings of the National Academy of Sciences. 2. Vignati, L., et al. (2007). "Exendin-4 and its role in type 2 diabetes treatment." Diabetes Care.
Hot Tags: exendin-4, exendin-4 suppliers, peptides distribution, peptides application, peptides for therapeutics, peptides catalogue, peptides in pharmaceuticals, peptides for skin care
You Might Also Like









