Latest Products
Contact Us
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, China
- sales@biorunstar.com
- +86-0755 2308 4243
Exendin-3 is a biologically active peptide derived from the venom of the Gila monster (Heloderma horridum). It belongs to the exendin family of peptides, which are structurally similar to glucagon-like peptide-1 (GLP-1), and has shown significant effects on insulin secretion.
Specifications
|
Sequence one letter code |
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
|
Sequence three letter code |
His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
|
CAS Number |
130357-25-4 |
|
Molecular Formula |
C184H282N50O61S1 |
|
Molecular Weight |
4202.63 |
|
Modification |
C-terminal Amidation |
|
Purity |
Peak Area by HPLC ≥95% |
|
Form |
Lyophilized |
|
Long Storage |
- 20 °C or below |
| For Research Use Only. | |
References:
1. Habener, J. F., et al., "Gila Monster Venom, Gut Hormones, and Diabetes: The Winding Path to Drug Discovery," Pharmacy Times 2. Drucker, D. J., "Glucagon-like peptide 1 and its therapeutic potential," Proceedings of the National Academy of Sciences.
Hot Tags: exendin-3, exendin-3 suppliers, Beta Amyloid 1 40 Human CAS 144409 98 3, peptides for genetic disorder research, RVG29-Cys, peptides for diagnostic assays, cyclic rgd peptide, rgdfk peptide
You Might Also Like
